Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rrp7a Peptide - C-terminal region

Rrp7a Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cgi-96, RGD1311547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rrp7a Rabbit Polyclonal Antibody (orb577788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

D4AE65

Preservative

Lyophilized powder

AA Sequence

KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sec23ip activation kit by CRISPRa
GA212809 1 Kit

Mouse Sec23ip activation kit by CRISPRa

Sign In for Pricing
View Details
Human PLP1 protein
orb595176-01 20 µg

Human PLP1 protein

Sign In for Pricing
View Details
Human PLP1 protein
orb595176-02 100 µg

Human PLP1 protein

Sign In for Pricing
View Details
PIPES Buffer 0.5M, pH 6.5
41620031-2 250 mL

PIPES Buffer 0.5M, pH 6.5

Sign In for Pricing
View Details
MYH13 Polyclonal Antibody
MBS8569313-01 0.1 mL

MYH13 Polyclonal Antibody

Sign In for Pricing
View Details
MYH13 Polyclonal Antibody
MBS8569313-02 0.1 mL (AF405L)

MYH13 Polyclonal Antibody

Sign In for Pricing
View Details