Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLP1 protein

This Human PLP1 protein spans the amino acid sequence from region 2-277aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipophilin PLP

UniProt

P60201

Expression Region

2-277aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 Human shRNA Lentiviral Particle (Locus ID 6657)
TL309173V 500 µL Each

SOX2 Human shRNA Lentiviral Particle (Locus ID 6657)

Sign In for Pricing
View Details
Mouse Ppp2r2c (NM_172994) AAV Particle
MR207132A1V 250 µL

Mouse Ppp2r2c (NM_172994) AAV Particle

Sign In for Pricing
View Details
Recombinant Human Brain and Acute Leukemia, Cytoplamatic
MBS556293-01 0.002 mg

Recombinant Human Brain and Acute Leukemia, Cytoplamatic

Sign In for Pricing
View Details
Recombinant Human Brain and Acute Leukemia, Cytoplamatic
MBS556293-02 0.1 mg

Recombinant Human Brain and Acute Leukemia, Cytoplamatic

Sign In for Pricing
View Details
Recombinant Human Brain and Acute Leukemia, Cytoplamatic
MBS556293-03 5x 0.01 mg

Recombinant Human Brain and Acute Leukemia, Cytoplamatic

Sign In for Pricing
View Details
2-[1- (2,2-Diethoxyethyl) -1H-1,2,3-triazol-4-yl]ethan-1-ol
QLB36954-01 250 mg

2-[1- (2,2-Diethoxyethyl) -1H-1,2,3-triazol-4-yl]ethan-1-ol

Sign In for Pricing
View Details