Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLP1 protein

This Human PLP1 protein spans the amino acid sequence from region 2-277aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipophilin PLP

UniProt

P60201

Expression Region

2-277aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Beta-Hydroxy Cholesterol
TRC-H917980-25MG 25 mg

4-Beta-Hydroxy Cholesterol

Sign In for Pricing
View Details
Adenovirus 5 E1A Polyclonal Antibody, APC-Cy7 Conjugated
bs-6136R-APC-Cy7 100 µL

Adenovirus 5 E1A Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
ML-335 5mg
A22244-5 5 mg

ML-335 5mg

Sign In for Pricing
View Details
Rat Necab3 Pre-designed siRNA Set A
SI209177A 1 Each

Rat Necab3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Collagen I alpha 2 Antibody
RC-16822-01 50 μL

Recombinant Collagen I alpha 2 Antibody

Sign In for Pricing
View Details
Recombinant Collagen I alpha 2 Antibody
RC-16822-02 100 µL

Recombinant Collagen I alpha 2 Antibody

Sign In for Pricing
View Details