Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mprip Peptide - middle region

Mprip Peptide - middle region

Product Specifications

Product Name Alternative

M-rip, Mrip, Rhoip3, p116Rip

UniProt

Q9ERE6

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mprip Rabbit Polyclonal Antibody (orb583750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446266

Preservative

Lyophilized powder

AA Sequence

ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC36A4 (PAT4) discontinued
514294 100 µg

SLC36A4 (PAT4) discontinued

Sign In for Pricing
View Details
CKMM antibody
MBS531826-01 1 mg

CKMM antibody

Sign In for Pricing
View Details
CKMM antibody
MBS531826-02 5x 1 mg

CKMM antibody

Sign In for Pricing
View Details
MDM4/MDMX, Human (His)
HY-P74756-01 5 µg

MDM4/MDMX, Human (His)

Sign In for Pricing
View Details
MDM4/MDMX, Human (His)
HY-P74756-02 10 µg

MDM4/MDMX, Human (His)

Sign In for Pricing
View Details
MDM4/MDMX, Human (His)
HY-P74756-03 50 µg

MDM4/MDMX, Human (His)

Sign In for Pricing
View Details