Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM4/MDMX, Human (His)

MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MDM4/MDMX Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdm4-mdmx-protein-human-his.html

Purity

95.00

Smiles

MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQD

Molecular Formula

4194 (Gene_ID) O15151-1/NP_002384.2 (M1-D134) (Accession)

Molecular Weight

Approximately 19.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF13B
CSB-CL897523HU 10 μg Plasmid + 200 μL Glycerol

TNFSF13B

Sign In for Pricing
View Details
Goat Cholecystokinin-33 (CCK33) ELISA Kit
MBS9344663 Inquire

Goat Cholecystokinin-33 (CCK33) ELISA Kit

Sign In for Pricing
View Details
MUS81 Rabbit Polyclonal Antibody
E28PN6746 100 µL

MUS81 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fyn, p59 (Src Family Tyrosine Kinase) (MaxLight 750) discontinued
F9500-09-ML750 100 µL

Fyn, p59 (Src Family Tyrosine Kinase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AKT Rabbit Monoclonal Antibody, 1 pack = 50 µL
BAL3988 1 Each

AKT Rabbit Monoclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
AGGF1, NT (AGGF1, GPATC7, GPATCH7, VG5Q, Angiogenic factor with G patch and FHA domains 1, Angiogenic factor VG5Q, G patch domain-containing protein 7, Vasculogenesis gene on 5q protein) (Azide free) (HRP) discontinued
031696-HRP 200 µL

AGGF1, NT (AGGF1, GPATC7, GPATCH7, VG5Q, Angiogenic factor with G patch and FHA domains 1, Angiogenic factor VG5Q, G patch domain-containing protein 7, Vasculogenesis gene on 5q protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details