Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDM4/MDMX, Human (His)

MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MDM4/MDMX Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdm4-mdmx-protein-human-his.html

Purity

95.00

Smiles

MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQD

Molecular Formula

4194 (Gene_ID) O15151-1/NP_002384.2 (M1-D134) (Accession)

Molecular Weight

Approximately 19.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin, Smooth Muscle, Heavy Chain 2 (MHC-2)
MBS622579-01 0.5 mL

Myosin, Smooth Muscle, Heavy Chain 2 (MHC-2)

Sign In for Pricing
View Details
Myosin, Smooth Muscle, Heavy Chain 2 (MHC-2)
MBS622579-02 5x 0.5 mL

Myosin, Smooth Muscle, Heavy Chain 2 (MHC-2)

Sign In for Pricing
View Details
Mfap1a sgRNA CRISPR Lentivector set (Rat)
K6578101 3x 1.0 µg

Mfap1a sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
CECR2 Rabbit Polyclonal Antibody (FITC)
orb186833 100 µL

CECR2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal Rac1 Antibody [Janelia Fluor 549]
NBP2-99370JF549 0.1 mL

Rabbit Polyclonal Rac1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal PLGF Antibody (37203.111) [Alexa Fluor 750]
NB120-10966AF750 0.1 mL

Mouse Monoclonal PLGF Antibody (37203.111) [Alexa Fluor 750]

Sign In for Pricing
View Details