Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDHD5 Peptide - C-terminal region

HDHD5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CECR5

UniProt

Q9BXW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HDHD5 Rabbit Polyclonal Antibody (orb587059) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149061

Preservative

Lyophilized powder

AA Sequence

SQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)
orb2910549-01 20 µg

Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)

Sign In for Pricing
View Details
Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)
orb2910549-02 100 µg

Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)

Sign In for Pricing
View Details
EV450 Anti-Mouse/Human KLRG-1 Antibody
JOT22979F 20Tests

EV450 Anti-Mouse/Human KLRG-1 Antibody

Sign In for Pricing
View Details
Human MFSD11 Knockout A549 cell line
GTR15416263 1 Vial

Human MFSD11 Knockout A549 cell line

Sign In for Pricing
View Details
2-Bromo-1-[3-bromo-5- (trifluoromethyl) phenyl]ethanone
PC1009222 250 mg

2-Bromo-1-[3-bromo-5- (trifluoromethyl) phenyl]ethanone

Sign In for Pricing
View Details
CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075) (FITC)
MBS6468536-01 0.1 mL

CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO10075) (FITC)

Sign In for Pricing
View Details