Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)

This Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 1

UniProt

Q5HZI9

Expression Region

1-298

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDSEAHEKRPPMLTSSNQDLSPHIAGVGDMKHYLCGYCAAFNNVAITYPVQKILFRQQL YGIKTRDAVLQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLHKHVSSAPEFA TRSVAALLAGTTEAILTPFERVQTLLQDHKHHDKFTNTYQAFRALRCHGIAEYYRGMVPI LFRNGFGNVLFFGLRGPIKESLPTATTYSAHLVNDFICGGVLGAVLGFLSFPINVVKARI QSQIGGPFLSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nephronectin (NPNT) Recombinant, Human
156040-01 10 µg

Nephronectin (NPNT) Recombinant, Human

Sign In for Pricing
View Details
Nephronectin (NPNT) Recombinant, Human
156040-02 50 µg

Nephronectin (NPNT) Recombinant, Human

Sign In for Pricing
View Details
Nephronectin (NPNT) Recombinant, Human
156040-03 200 µg

Nephronectin (NPNT) Recombinant, Human

Sign In for Pricing
View Details
MSH, VA-beta (Human) - Cy3 Labeled
FC3-043-42 1 nmol

MSH, VA-beta (Human) - Cy3 Labeled

Sign In for Pricing
View Details
Canine F-box-like/WD repeat-containing protein TBL1XR1 (TBL1XR1) ELISA Kit
MBS7200172-01 48 Well

Canine F-box-like/WD repeat-containing protein TBL1XR1 (TBL1XR1) ELISA Kit

Sign In for Pricing
View Details
Canine F-box-like/WD repeat-containing protein TBL1XR1 (TBL1XR1) ELISA Kit
MBS7200172-02 96 Well

Canine F-box-like/WD repeat-containing protein TBL1XR1 (TBL1XR1) ELISA Kit

Sign In for Pricing
View Details