Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1)

This Recombinant Mouse Mitochondrial carrier triple repeat protein 1 (Mcart1) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Mitochondrial carrier triple repeat protein 1

UniProt

Q5HZI9

Expression Region

1-298

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDSEAHEKRPPMLTSSNQDLSPHIAGVGDMKHYLCGYCAAFNNVAITYPVQKILFRQQL YGIKTRDAVLQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLHKHVSSAPEFA TRSVAALLAGTTEAILTPFERVQTLLQDHKHHDKFTNTYQAFRALRCHGIAEYYRGMVPI LFRNGFGNVLFFGLRGPIKESLPTATTYSAHLVNDFICGGVLGAVLGFLSFPINVVKARI QSQIGGPFLSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-6-chloro-4-fluorobenzaldehyde
IHC99064 2.5 g

2-Bromo-6-chloro-4-fluorobenzaldehyde

Sign In for Pricing
View Details
APOM (Apolipoprotein M, G3a, HSPC336, MGC22400, NG20) (AP) discontinued
243422-AP 100 µL

APOM (Apolipoprotein M, G3a, HSPC336, MGC22400, NG20) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF576 Antibody [FITC]
NBP2-97980F 0.1 mL

Rabbit Polyclonal ZNF576 Antibody [FITC]

Sign In for Pricing
View Details
KRT83 Rabbit Polyclonal Antibody (BF750)
orb2495890 100 µL

KRT83 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
CD8 (C8/468), 0.2mg/mL
BNUB0468-500 1x 500 µL

CD8 (C8/468), 0.2mg/mL

Sign In for Pricing
View Details
Olr556 Rat siRNA Oligo Duplex (Locus ID 405249)
SR500690 1 Kit

Olr556 Rat siRNA Oligo Duplex (Locus ID 405249)

Sign In for Pricing
View Details