Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB8 Peptide - N-terminal region

PSMB8 Peptide - N-terminal region

Product Specifications

UniProt

P28062

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMB8 Rabbit Polyclonal Antibody (orb330468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIPK9 Antibody
orb838955 2 mg

CIPK9 Antibody

Sign In for Pricing
View Details
(3S) -Tanzisertib hydrochloride
T207342-01 10 mg

(3S) -Tanzisertib hydrochloride

Sign In for Pricing
View Details
(3S) -Tanzisertib hydrochloride
T207342-02 50 mg

(3S) -Tanzisertib hydrochloride

Sign In for Pricing
View Details
Anti-NGF/bNGF Reference Antibody (Izenivetmab)
MBS9247810-01 0.1 mg

Anti-NGF/bNGF Reference Antibody (Izenivetmab)

Sign In for Pricing
View Details
Anti-NGF/bNGF Reference Antibody (Izenivetmab)
MBS9247810-02 5x 0.1 mg

Anti-NGF/bNGF Reference Antibody (Izenivetmab)

Sign In for Pricing
View Details
Recombinant Chicken Interleukin 16 (IL16)
RPU57946-01 50 µg

Recombinant Chicken Interleukin 16 (IL16)

Sign In for Pricing
View Details