Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHBDL2 Peptide - N-terminal region

RHBDL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RRP2

UniProt

B3KUN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RHBDL2 Rabbit Polyclonal Antibody (orb325335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060291

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cox6a1 Rat siRNA Oligo Duplex (Locus ID 25282)
SR501754 1 Kit

Cox6a1 Rat siRNA Oligo Duplex (Locus ID 25282)

Sign In for Pricing
View Details
Tns4 ORF Vector (Rat) (pORF)
47270016 1.0 µg DNA

Tns4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Neuromedin U Rabbit Polyclonal Antibody (FITC)
orb464027 100 µL

Neuromedin U Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Prdm9 Antibody
orb860882 2 mg

Prdm9 Antibody

Sign In for Pricing
View Details
Human MBNL1 protein
orb244986-01 20 µg

Human MBNL1 protein

Sign In for Pricing
View Details
Human MBNL1 protein
orb244986-02 100 µg

Human MBNL1 protein

Sign In for Pricing
View Details