Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MBNL1 protein

This Human MBNL1 protein spans the amino acid sequence from region 1-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MBNL1

UniProt

Q9NR56

Expression Region

1-382aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Legionella Pneumophila panC Protein (aa 1-252) (strain Corby)
VAng-Lsx04446-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila panC Protein (aa 1-252) (strain Corby)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) YADE Polyclonal Antibody
MBS7154852 Inquire

Rabbit anti-Escherichia coli (strain K12) YADE Polyclonal Antibody

Sign In for Pricing
View Details
Renalase Polyclonal Antibody, PE Conjugated
bs-7693R-PE-01 20 µL

Renalase Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Renalase Polyclonal Antibody, PE Conjugated
bs-7693R-PE-02 100 µL

Renalase Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Goat B-cell scaffold protein with ankyrin repeats (BANK1) ELISA Kit
MBS7217962-01 48 Well

Goat B-cell scaffold protein with ankyrin repeats (BANK1) ELISA Kit

Sign In for Pricing
View Details
Goat B-cell scaffold protein with ankyrin repeats (BANK1) ELISA Kit
MBS7217962-02 96 Well

Goat B-cell scaffold protein with ankyrin repeats (BANK1) ELISA Kit

Sign In for Pricing
View Details