Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MBNL1 protein

This Human MBNL1 protein spans the amino acid sequence from region 1-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MBNL1

UniProt

Q9NR56

Expression Region

1-382aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Carboxypeptidase N1 (CPN1) ELISA Kit
EK13405 48 Tests

Mouse Carboxypeptidase N1 (CPN1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Histone H2AX (phospho S139) Antibody
RC-6379-01 50 μL

Recombinant Histone H2AX (phospho S139) Antibody

Sign In for Pricing
View Details
Recombinant Histone H2AX (phospho S139) Antibody
RC-6379-02 100 µL

Recombinant Histone H2AX (phospho S139) Antibody

Sign In for Pricing
View Details
Recombinant Histone H2AX (phospho S139) Antibody
RC-6379-03 1 mL

Recombinant Histone H2AX (phospho S139) Antibody

Sign In for Pricing
View Details
Mouse Coro1b qPCR Primer Pair
QM23854S 200 Tests

Mouse Coro1b qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral mouse Hs3st3b1 shRNA (UAS) - Lentiviral mouse Hs3st3b1 shRNA (UAS, iRFP) plasmid
GTR15118312 1 Vial

Lentiviral mouse Hs3st3b1 shRNA (UAS) - Lentiviral mouse Hs3st3b1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details