Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MERTK Peptide - N-terminal region

MERTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

MERTK, MER

UniProt

Q12866

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MERTK Rabbit Polyclonal Antibody (orb584200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006334

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Exportin-T Antibody
NBP1-57176 100 µL

Rabbit Polyclonal Exportin-T Antibody

Sign In for Pricing
View Details
MUC5AC antibody
orb2276599-01 0.1 mL

MUC5AC antibody

Sign In for Pricing
View Details
MUC5AC antibody
orb2276599-02 0.5 mL

MUC5AC antibody

Sign In for Pricing
View Details
MUC5AC antibody
orb2276599-03 1 mL

MUC5AC antibody

Sign In for Pricing
View Details
Human LAMa4 (Laminin Alpha 4) Microsample ELISA Kit
ELK4038MS-01 48 Tests

Human LAMa4 (Laminin Alpha 4) Microsample ELISA Kit

Sign In for Pricing
View Details
Human LAMa4 (Laminin Alpha 4) Microsample ELISA Kit
ELK4038MS-02 96 Tests

Human LAMa4 (Laminin Alpha 4) Microsample ELISA Kit

Sign In for Pricing
View Details