NCLN Peptide - N-terminal region
NCLN Peptide - N-terminal region
Product Specifications
Product Name Alternative
NCLN
UniProt
Q969V3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NCLN Rabbit Polyclonal Antibody (orb588307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
5414-AAT 2 Labelings
Buccutite™ Rapid APC-Cy5.5 Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*
Sign In for Pricing
View Details 