Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FASTK Peptide - N-terminal region

FASTK Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST

UniProt

Q14296

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FASTK Rabbit Polyclonal Antibody (orb588774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001245390.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lactobacillus reuteri ATP synthase subunit a (atpB)
orb2917478-01 20 µg

Recombinant Lactobacillus reuteri ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Lactobacillus reuteri ATP synthase subunit a (atpB)
orb2917478-02 100 µg

Recombinant Lactobacillus reuteri ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
IL-13 Recombinant Protein
91-928 0.05 mg

IL-13 Recombinant Protein

Sign In for Pricing
View Details
NCK2 Lentiviral Activation Particles (m2)
sc-421834-LAC-2 200 µL

NCK2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
IPA (Indole-3-propionic acid)
I-410-250-250g 250 g

IPA (Indole-3-propionic acid)

Sign In for Pricing
View Details
Lithium Hydroxide Monohydrate 98%
GPC1899-2X 250 g

Lithium Hydroxide Monohydrate 98%

Sign In for Pricing
View Details