Recombinant Lactobacillus reuteri ATP synthase subunit a (atpB)
This Recombinant Lactobacillus reuteri ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-235.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
B2G685
Expression Region
1-235
Origin
Lactobacillus reuteri (strain JCM 1112)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGGDALTFKLFGLTFNTTNIVSGLIIYAIVFFTLYGMSRKIQMKPTGAQNVFEWLVDFTN GIVRSQMPASEQGHYSFFAFVLFVFIFFANQFGLIFQFHWNGAEVLRSPTADPVVTLTLS LMVMVLAFAAGVAHNGLGGYLKGYTKPFTLMLPVNIIEDFANFLTLGLRIFGNIFAGELL MSLIANMAFSHGILTIIPGLFLELAWQGFSVFIGSIQAYVFVTLTTVYISRKISE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 