ABLM1 Peptide - C-terminal region
ABLM1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ABLIM, LIMAB1, LIMATIN, abLIM-1
UniProt
O14639
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ABLM1 Rabbit Polyclonal Antibody (orb584447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001003407
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKL
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-5856R-BF647-TR 20 µL
ADAMTS13 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details 
TMB_TSB_F100_6 6 x 100 mL Bottles
Trypticasein Soy Broth (TSB) 6 x 100 ml Bottles
Sign In for Pricing
View Details 
orb3009547-01 20 µg
Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)
Sign In for Pricing
View Details orb3009547-02 100 µg
Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)
Sign In for Pricing
View Details orb3009547-03 1 mg
Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)
Sign In for Pricing
View Details GTR15234469 1 Vial
Lentiviral mouse Rbpj shRNA (UAS) - Lentiviral mouse Rbpj shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details