Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOD Blocking Peptide
33R-8964 0.1 mg

RHOD Blocking Peptide

Sign In for Pricing
View Details
Human EGF Protein Lysate
MBS8410941-01 0.02 mg

Human EGF Protein Lysate

Sign In for Pricing
View Details
Human EGF Protein Lysate
MBS8410941-02 5x 0.02 mg

Human EGF Protein Lysate

Sign In for Pricing
View Details
Fibroblast Growth Factor, Basic, Recombinant, Human (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) discontinued. see F4210-10G
F4210-15K 50 µg

Fibroblast Growth Factor, Basic, Recombinant, Human (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) discontinued. see F4210-10G

Sign In for Pricing
View Details
Human CHCHD4 protein
orb244920-01 20 µg

Human CHCHD4 protein

Sign In for Pricing
View Details
Human CHCHD4 protein
orb244920-02 100 µg

Human CHCHD4 protein

Sign In for Pricing
View Details