Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-20 (HV320)

This Recombinant Human Immunoglobulin heavy variable 3-20 (HV320) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-20 IGHV3-20

UniProt

A0A0C4DH32

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNGGSTGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYHCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK10 Antibody (FITC)
orb243760-01 50 µg

KLK10 Antibody (FITC)

Sign In for Pricing
View Details
KLK10 Antibody (FITC)
orb243760-02 100 µg

KLK10 Antibody (FITC)

Sign In for Pricing
View Details
Decr1 Mouse shRNA Lentiviral Particle (Locus ID 67460)
TL503911V 500 µL Each

Decr1 Mouse shRNA Lentiviral Particle (Locus ID 67460)

Sign In for Pricing
View Details
Fndc5 Adenovirus (Mouse)
20724054 750 µL

Fndc5 Adenovirus (Mouse)

Sign In for Pricing
View Details
RFESD CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38856154 3x 1.0 µg DNA

RFESD CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Human YEATS domain-containing protein 2 (YEATS2) ELISA Kit
AE10944HU-01 48 Tests

Human YEATS domain-containing protein 2 (YEATS2) ELISA Kit

Sign In for Pricing
View Details