Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML1 Peptide - C-terminal region

TREML1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLTL1825, MGC119173, PRO3438, TLT-1, TLT1, dJ238O23.3

UniProt

Q86YW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREML1 Rabbit Polyclonal Antibody (orb331313) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835468

Preservative

Lyophilized powder

AA Sequence

PSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor™ 647 Conjugated Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]
HA720142F 100 µL

iFluor™ 647 Conjugated Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]

Sign In for Pricing
View Details
Mouse Arf6 activation kit by CRISPRa
GA200269 1 Kit

Mouse Arf6 activation kit by CRISPRa

Sign In for Pricing
View Details
3-(Diethylboryl)pyridine
TRC-D442040-1G 1 g

3-(Diethylboryl)pyridine

Sign In for Pricing
View Details
Recombinant Human TIMP3 protein (His tag)
PDEH100896-01 20 µg

Recombinant Human TIMP3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TIMP3 protein (His tag)
PDEH100896-02 100 µg

Recombinant Human TIMP3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TIMP3 protein (His tag)
PDEH100896-03 500 µg

Recombinant Human TIMP3 protein (His tag)

Sign In for Pricing
View Details