Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIKESHI Peptide - N-terminal region

HIKESHI Peptide - N-terminal region

Product Specifications

Product Name Alternative

L7Rn6

UniProt

Q5M808

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HIKESHI Rabbit Polyclonal Antibody (orb326134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001013919

Preservative

Lyophilized powder

AA Sequence

GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neuronal Pentraxin I (NPTX1)
RPU43015-01 50 µg

Recombinant Human Neuronal Pentraxin I (NPTX1)

Sign In for Pricing
View Details
Recombinant Human Neuronal Pentraxin I (NPTX1)
RPU43015-02 100 µg

Recombinant Human Neuronal Pentraxin I (NPTX1)

Sign In for Pricing
View Details
Recombinant Human Neuronal Pentraxin I (NPTX1)
RPU43015-03 1 mg

Recombinant Human Neuronal Pentraxin I (NPTX1)

Sign In for Pricing
View Details
FZL Antibody
PHY1895S 150 μg

FZL Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)
orb2933876-01 20 µg

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)
orb2933876-02 100 µg

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

Sign In for Pricing
View Details