Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q5HHD5

Expression Region

1-113

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC68 3'UTR Luciferase Stable Cell Line
TU018064 1.0 mL

PIRC68 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human PLSCR1 Protein, N-His
orb2837056-01 20 µg

Recombinant Human PLSCR1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PLSCR1 Protein, N-His
orb2837056-02 50 µg

Recombinant Human PLSCR1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PLSCR1 Protein, N-His
orb2837056-03 100 µg

Recombinant Human PLSCR1 Protein, N-His

Sign In for Pricing
View Details
Mouse Monoclonal Vimentin Antibody (VM452) [Janelia Fluor 646]
NBP2-33060JF646 0.1 mL

Mouse Monoclonal Vimentin Antibody (VM452) [Janelia Fluor 646]

Sign In for Pricing
View Details
CRHR2 Blocking Peptide
CBP6190-01 1 mg

CRHR2 Blocking Peptide

Sign In for Pricing
View Details