Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q5HHD5

Expression Region

1-113

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEAN VKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV694373 1.0 µg DNA

PTPN9 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2)
311001-01 50 µg

CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2)

Sign In for Pricing
View Details
CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2)
311001-02 100 µg

CKS2 (CDC28 Protein Kinase Regulatory Subunit 2, CKSHS2)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4 (IZH4)
MBS7017569-01 0.02 mg

Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4 (IZH4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4 (IZH4)
MBS7017569-02 0.1 mg

Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4 (IZH4)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4 (IZH4)
MBS7017569-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae ADIPOR-like receptor IZH4 (IZH4)

Sign In for Pricing
View Details