WIPF1 Peptide - middle region
WIPF1 Peptide - middle region
Product Specifications
Product Name Alternative
WIP, WAS2, PRPL-2, WASPIP
UniProt
O43516
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WIPF1 Rabbit Polyclonal Antibody (orb588389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001070737.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3010885-01 20 µg
Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)
Sign In for Pricing
View Details orb3010885-02 100 µg
Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)
Sign In for Pricing
View Details orb3010885-03 1 mg
Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)
Sign In for Pricing
View Details 
ICA62151-01 0.5 g
1- (2-Methyl-2,3-dihydro-1-benzofuran-5-yl) ethan-1-one
Sign In for Pricing
View Details ICA62151-02 5 g
1- (2-Methyl-2,3-dihydro-1-benzofuran-5-yl) ethan-1-one
Sign In for Pricing
View Details 