Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1G2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]
TA802813AM 100 µL

CSNK1G2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS710931 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[BC8]
E-AB-F13720P-01 25 µg

Purified Anti-Human CD45 Antibody[BC8]

Sign In for Pricing
View Details
Purified Anti-Human CD45 Antibody[BC8]
E-AB-F13720P-02 100 µg

Purified Anti-Human CD45 Antibody[BC8]

Sign In for Pricing
View Details
Tcl1b5 Mouse Gene Knockout Kit (CRISPR)
KN517340 1 Kit

Tcl1b5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1491), CF594 conjugate, 0.1mg/mL
BNC941491-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1491), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details