Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiol Microplate Assay Kit
RDSM146 100 Assays

Thiol Microplate Assay Kit

Sign In for Pricing
View Details
2’-Deoxyadenosine 5’Monophosphate
TRC-D231630-1G 1 g

2’-Deoxyadenosine 5’Monophosphate

Sign In for Pricing
View Details
BAG5 Mouse Monoclonal Antibody [Clone ID: OTI2D6]
CF810619 100 µg

BAG5 Mouse Monoclonal Antibody [Clone ID: OTI2D6]

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 1mg/mL
BNUM1283-50 1x 50 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 1mg/mL

Sign In for Pricing
View Details
TIAL1 (NM_003252) Human Over-expression Lysate
LY401121 100 µg

TIAL1 (NM_003252) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (rKRT18/1190), CF405S conjugate, 0.1mg/mL
BNC043217-500 1x 500 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details