Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTNAP2 Peptide - middle region

CNTNAP2 Peptide - middle region

Product Specifications

Product Name Alternative

CDFE, NRXN4, AUTS15, CASPR2, PTHSL1

UniProt

A0A0J9YYA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNTNAP2 Rabbit Polyclonal Antibody (orb589518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_054860.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRBN ligand-11
HY-169989-01 100 mg

CRBN ligand-11

Sign In for Pricing
View Details
CRBN ligand-11
HY-169989-02 250 mg

CRBN ligand-11

Sign In for Pricing
View Details
CRBN ligand-11
HY-169989-03 500 mg

CRBN ligand-11

Sign In for Pricing
View Details
CRBN ligand-11
HY-169989-04 1 g

CRBN ligand-11

Sign In for Pricing
View Details
CRBN ligand-11
HY-169989-05 5 g

CRBN ligand-11

Sign In for Pricing
View Details
CRBN ligand-11
HY-169989-06 10 g

CRBN ligand-11

Sign In for Pricing
View Details