What is the catalog number for KLF6 Peptide - middle region?

The catalog number for KLF6 Peptide - middle region is orb1997871.

What sizes are available for KLF6 Peptide - middle region?

KLF6 Peptide - middle region is available in the following size(s): 100 µg.

Is KLF6 Peptide - middle region in stock?

KLF6 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KLF6 Peptide - middle region

Product Specifications

Product Name Alternative

FM2, FM6, Zf9, BCD1, CPBP, Copeb, C86813, R75280, Ierepo1, Ierepo3, AI448727

UniProt

O08584

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKISSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2089458 100 µL

SKAP2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

EK240088 96 Well

Guinea pig C3 (Complement Component 3) ELISA Kit

Sign In for Pricing

View Details

orb2009638 100 µg

OTUD6A Peptide - middle region

Sign In for Pricing

View Details

NB100-401JF646 0.1 mL

Rabbit Polyclonal SAH3 Antibody [Janelia Fluor 646]

Sign In for Pricing

View Details

B2012148 100 µg

Human DENR Protein

Sign In for Pricing

View Details

A07201-2 100 µL

Anti-IFRD1 Antibody

Sign In for Pricing

View Details