Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUD6A Peptide - middle region

OTUD6A Peptide - middle region

Product Specifications

Product Name Alternative

DUBA2, FLJ25831, HSHIN6

UniProt

Q7L8S5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTUD6A Rabbit Polyclonal Antibody (orb331027) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997203

Preservative

Lyophilized powder

AA Sequence

KMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR1 (SRI) (NM_003130) Human Tagged Lenti ORF Clone
RC203130L2 10 µg

SR1 (SRI) (NM_003130) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse 1500009L16Rik shRNA (UAS) - Lentiviral mouse 1500009L16Rik shRNA (UAS, RFP) (25)
GTR15298046 1 Vial

Lentiviral mouse 1500009L16Rik shRNA (UAS) - Lentiviral mouse 1500009L16Rik shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
(S) -2-Aminobutane-1,4-dithiol hydrochloride
OR1072795-01 100 mg

(S) -2-Aminobutane-1,4-dithiol hydrochloride

Sign In for Pricing
View Details
(S) -2-Aminobutane-1,4-dithiol hydrochloride
OR1072795-02 250 mg

(S) -2-Aminobutane-1,4-dithiol hydrochloride

Sign In for Pricing
View Details
(S) -2-Aminobutane-1,4-dithiol hydrochloride
OR1072795-03 1 g

(S) -2-Aminobutane-1,4-dithiol hydrochloride

Sign In for Pricing
View Details
(S) -2-Aminobutane-1,4-dithiol hydrochloride
OR1072795-04 5 g

(S) -2-Aminobutane-1,4-dithiol hydrochloride

Sign In for Pricing
View Details