RAB14 Peptide - C-terminal region
RAB14 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI314285, AI649155, 0610030G24Rik, 2810475J17Rik, A830021G03Rik, D030017L14Rik
UniProt
Q91V41
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_080973.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1259898-01 0.02 mg (E-Coli)
Recombinant Pisum sativum Small heat shock protein, chloroplastic (HSP21)
Sign In for Pricing
View Details MBS1259898-02 0.1 mg (E-Coli)
Recombinant Pisum sativum Small heat shock protein, chloroplastic (HSP21)
Sign In for Pricing
View Details MBS1259898-03 0.02 mg (Yeast)
Recombinant Pisum sativum Small heat shock protein, chloroplastic (HSP21)
Sign In for Pricing
View Details MBS1259898-04 0.1 mg (Yeast)
Recombinant Pisum sativum Small heat shock protein, chloroplastic (HSP21)
Sign In for Pricing
View Details MBS1259898-05 0.02 mg (Baculovirus)
Recombinant Pisum sativum Small heat shock protein, chloroplastic (HSP21)
Sign In for Pricing
View Details MBS1259898-06 0.02 mg (Mammalian-Cell)
Recombinant Pisum sativum Small heat shock protein, chloroplastic (HSP21)
Sign In for Pricing
View Details