Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantIGF-BP-4, His, Human

Insulin-like growth factor-binding protein 4 (IGF-BP-4), also known as IBP-4, is a secreted glycoprotein belonging to the IGFBP family. IGF-BP-4 is produced by osteoblasts, epidermis, ovarian follicles and other tissues. It binds both insulin-like growth factor (IGF) I and II, and it circulates in the plasma in both glycosylated and non-glycosylated forms. IGF-BP-4 prolongs the half-life of the IGFs and has been shown to inhibit or stimulate the growth-promoting effects of the IGFs. Pregnancy Associated Plasma Protein A (PAPP-A) proteolytically cleaves IGF-BP-4 and reduces its affinity to bind IGFs, and thus serves as an important regulator of IGF-BP-4 function.

Product Specifications

Product Name Alternative

Insulin-like Growth Factor-Binding Protein 4, IBP-4, HT29-IGF-BP, colon cancer cell growth inhibitor

Source

HEK 293

Field of Research

Signal Transduction

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 50 ng/ml, measured in a bioassay using FDC-P1 cells in the presence of 15ng/ml human IGF-II.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

30-35 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant human IGF-BP-4 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human IGF-BP-4, His should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCM ELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRA LERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFREHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Z-WEHD-FMK
MBS5764137 Inquire

Z-WEHD-FMK

Sign In for Pricing
View Details
SNRPD2 Antibody
DF15356-01 100 µL

SNRPD2 Antibody

Sign In for Pricing
View Details
SNRPD2 Antibody
DF15356-02 200 µL

SNRPD2 Antibody

Sign In for Pricing
View Details
IgG2B Fc, Mouse (HEK293)
HY-P72602-01 10 µg

IgG2B Fc, Mouse (HEK293)

Sign In for Pricing
View Details
IgG2B Fc, Mouse (HEK293)
HY-P72602-02 50 µg

IgG2B Fc, Mouse (HEK293)

Sign In for Pricing
View Details
Lentiviral mouse Krt85 shRNA (UAS) - Lentiviral mouse Krt85 shRNA (UAS) plasmid
GTR15208219 1 Vial

Lentiviral mouse Krt85 shRNA (UAS) - Lentiviral mouse Krt85 shRNA (UAS) plasmid

Sign In for Pricing
View Details