Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM28 (NM_021777) Human Tagged Lenti ORF Clone
RC217827L1 10 µg

ADAM28 (NM_021777) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Irs2 (NM_001168633) Rat Tagged ORF Clone
RR217591 10 µg

Irs2 (NM_001168633) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mink1 Mouse qPCR Primer Pair (NM_001045964)
MP220758 200 Reactions

Mink1 Mouse qPCR Primer Pair (NM_001045964)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1431060-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1431060-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1431060-03 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details