Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a13 (NM_133980) Mouse Tagged ORF Clone Lentiviral Particle
MR208754L4V 200 µL

Slc22a13 (NM_133980) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (MaxLight 550)
135167-ML550 100 µL

USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003) (MaxLight 550)

Sign In for Pricing
View Details
RIPGBM
6892/10 10 mg

RIPGBM

Sign In for Pricing
View Details
IL18BP Polyclonal Antibody
ANT-12734-100ug 100 µg

IL18BP Polyclonal Antibody

Sign In for Pricing
View Details
SUN1 (NM_025154) Human Tagged ORF Clone Lentiviral Particle
RC224605L4V 200 µL

SUN1 (NM_025154) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
epDualfilt SealM 0.1-10uLS PCRSter 960
E0030078756 960 / PCK

epDualfilt SealM 0.1-10uLS PCRSter 960

Sign In for Pricing
View Details