Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2703618-01 24 Strip Well

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2703618-02 48 Well

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2703618-03 96 Well

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2703618-04 5x 96 Well

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
MBS2703618-05 10x 96 Well

Human Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Phosphatidylinositol Trisphosphate ELISA Kit
MBS7270652-01 48 Well

Guinea Pig Phosphatidylinositol Trisphosphate ELISA Kit

Sign In for Pricing
View Details