Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Fc gamma RIIIA/CD16a Antibody (ICO-116) [Alexa Fluor 750]
NBP2-47955AF750 0.1 mL

Mouse Monoclonal Fc gamma RIIIA/CD16a Antibody (ICO-116) [Alexa Fluor 750]

Sign In for Pricing
View Details
CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (FITC)
124874-FITC 100 µL

CER1 (Cerberus, Cerberus-related Protein, DAN Domain Family Member 4, DAND4) (FITC)

Sign In for Pricing
View Details
Guinea pig T cell growth factor III (TCGF-III) ELISA Kit
NSL0192Gp 96 Tests

Guinea pig T cell growth factor III (TCGF-III) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human SERPINB4 shRNA (UAS) - Lentiviral human SERPINB4 shRNA (UAS) (100)
GTR15311757 1 Vial

Lentiviral human SERPINB4 shRNA (UAS) - Lentiviral human SERPINB4 shRNA (UAS) (100)

Sign In for Pricing
View Details
Camel S100 Calcium Binding Protein A7 ELISA Kit
MBS058330-01 48 Well

Camel S100 Calcium Binding Protein A7 ELISA Kit

Sign In for Pricing
View Details
Camel S100 Calcium Binding Protein A7 ELISA Kit
MBS058330-02 96 Well

Camel S100 Calcium Binding Protein A7 ELISA Kit

Sign In for Pricing
View Details