Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL18 (NM_024963) Human Tagged ORF Clone Lentiviral Particle
RC220401L3V 200 µL

FBXL18 (NM_024963) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal ASC/TMS1 Antibody [Alexa Fluor 594]
NBP1-78978AF594 0.1 mL

Rabbit Polyclonal ASC/TMS1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
FBXO8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV710073 1.0 µg DNA

FBXO8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti Mouse CD272 (BTLA) Mab [6A6, 3F9.C6]
831023 100 µg

Anti Mouse CD272 (BTLA) Mab [6A6, 3F9.C6]

Sign In for Pricing
View Details
REG4 Rabbit pAb (APR19726N)
APR19726N-01 50 µL

REG4 Rabbit pAb (APR19726N)

Sign In for Pricing
View Details
REG4 Rabbit pAb (APR19726N)
APR19726N-02 100 µL

REG4 Rabbit pAb (APR19726N)

Sign In for Pricing
View Details