Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dimt1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4758502 1.0 µg DNA

Dimt1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
EGFL8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV709624 1.0 µg DNA

EGFL8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
AKIRIN1 Human Pre-designed siRNA Set A
HY-RS00527 1 Set

AKIRIN1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
IgG, H&L (Texas Red)
I1903-18W 500 µL

IgG, H&L (Texas Red)

Sign In for Pricing
View Details
FHIT sgRNA CRISPR Lentivector set (Human)
K0781701 3x 1.0 µg

FHIT sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
4a-Des (methylcarboxy), 4a (S) -carboxyethyl Indoxacarb
434055-01 1 mg

4a-Des (methylcarboxy), 4a (S) -carboxyethyl Indoxacarb

Sign In for Pricing
View Details