IgG2B Fc, Mouse (HEK293)
IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html
Purity
98.0
Smiles
EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Molecular Formula
16016 (Gene_ID) P01867-2 (E97-K335) (Accession)
Molecular Weight
31-37 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7021679-01 0.02 mg
Recombinant Balaenoptera physalus Cytochrome c oxidase subunit 3 (MT-CO3)
Sign In for Pricing
View Details 
MBS7021679-02 0.1 mg
Recombinant Balaenoptera physalus Cytochrome c oxidase subunit 3 (MT-CO3)
Sign In for Pricing
View Details 
MBS7021679-03 5x 0.1 mg
Recombinant Balaenoptera physalus Cytochrome c oxidase subunit 3 (MT-CO3)
Sign In for Pricing
View Details abx514956 96 Well
Mouse DNA Fragmentation Factor Subunit Beta (DFFB) ELISA Kit
Sign In for Pricing
View Details 