Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Collagen Type XI Alpha 1 (COL11A1) ELISA Kit
abx507827 96 Tests

Mouse Collagen Type XI Alpha 1 (COL11A1) ELISA Kit

Sign In for Pricing
View Details
Human WDR87 Knockout A549 cell line
GTR15414356 1 Vial

Human WDR87 Knockout A549 cell line

Sign In for Pricing
View Details
Rabbit Monoclonal LMO2 Antibody (LMO2/3147R) [DyLight 680]
NBP3-08945FR 100 µL

Rabbit Monoclonal LMO2 Antibody (LMO2/3147R) [DyLight 680]

Sign In for Pricing
View Details
FAM83C (NM_178468) Human Tagged ORF Clone
RC221152 10 µg

FAM83C (NM_178468) Human Tagged ORF Clone

Sign In for Pricing
View Details
Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA803388 100 µL

Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details
SETX Antibody, HRP conjugated
A60428-100UG 100 µg

SETX Antibody, HRP conjugated

Sign In for Pricing
View Details