Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEPDC1 Rabbit Polyclonal Antibody
E53P12226 100 µL

DEPDC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Calbindin (Clone: 4H7)
34-1018-50 50 μL

Monoclonal Antibody to Calbindin (Clone: 4H7)

Sign In for Pricing
View Details
Mouse Monoclonal JAM-B/VE-JAM Antibody (988934) [Janelia Fluor 549]
FAB10743I 0.1 mL

Mouse Monoclonal JAM-B/VE-JAM Antibody (988934) [Janelia Fluor 549]

Sign In for Pricing
View Details
Potassium bromate
GK4148-1kg 1 Kg

Potassium bromate

Sign In for Pricing
View Details
IKKB, phosphorylated (S689) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 650) discontinued
036959-ML650 100 µL

IKKB, phosphorylated (S689) (IKBKB, IKKB, Inhibitor of nuclear factor kappa-B kinase subunit beta, I-kappa-B kinase 2, Nuclear factor NF-kappa-B inhibitor kinase beta) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Cxcl5 3'UTR GFP Stable Cell Line
TU154585 1.0 mL

Cxcl5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details