Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Recombinant equine IL-12
GR104006 5 µg

Genorise® Recombinant equine IL-12

Sign In for Pricing
View Details
Human ACTG2 Protein Lysate
MBS136804-01 0.02 mg

Human ACTG2 Protein Lysate

Sign In for Pricing
View Details
Human ACTG2 Protein Lysate
MBS136804-02 5x 0.02 mg

Human ACTG2 Protein Lysate

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 1K1 (OR1K1), partial
MBS7096218 Inquire

Recombinant Human Olfactory receptor 1K1 (OR1K1), partial

Sign In for Pricing
View Details
Rabbit Monoclonal FDPS Antibody (115) [DyLight 594]
NBP2-90812DL594 0.1 mL

Rabbit Monoclonal FDPS Antibody (115) [DyLight 594]

Sign In for Pricing
View Details
Human Calpain 2 (CAPN2) activation kit by CRISPRa
GA100577 1 Kit

Human Calpain 2 (CAPN2) activation kit by CRISPRa

Sign In for Pricing
View Details