Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hgs (NM_019387) Rat Tagged ORF Clone
RR201860 10 µg

Hgs (NM_019387) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rabies Virus Mouse Monoclonal Antibody [Clone ID: 406]
BM3120 1 mg

Rabies Virus Mouse Monoclonal Antibody [Clone ID: 406]

Sign In for Pricing
View Details
CHS1 Antibody
A46346-100UG 100 µg

CHS1 Antibody

Sign In for Pricing
View Details
FRA10G sgRNA CRISPR Lentivector (Human) (Target 2)
K0807803 1.0 µg DNA

FRA10G sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TC2N (N-term) Rabbit Polyclonal Antibody
AP54137PU-N 400 µL

TC2N (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hexokinase 1 [ST47-05] Antibody
OM637278-01 100 µL

Hexokinase 1 [ST47-05] Antibody

Sign In for Pricing
View Details