Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf75 (tRNA Methyltransferase 11 Homolog (S. cerevisiae), C6orf75, MDS024, TRM11, dJ187J11, dJ187J11.2)
244079 50 µL

C6orf75 (tRNA Methyltransferase 11 Homolog (S. cerevisiae), C6orf75, MDS024, TRM11, dJ187J11, dJ187J11.2)

Sign In for Pricing
View Details
MBNL1 Protein Vector (Mouse) (pPB-C-His)
PV199566 500 ng

MBNL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human CD33-coupled Magnetic Beads
MBC-K008-10mg 10 mg

Human CD33-coupled Magnetic Beads

Sign In for Pricing
View Details
PSMB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1739907 1.0 µg DNA

PSMB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Tuba1c sgRNA CRISPR Lentivector set (Rat)
K6728001 3x 1.0 µg

Tuba1c sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
p53 (pS9) Blocking Peptide
MBS8243686-01 1 mg

p53 (pS9) Blocking Peptide

Sign In for Pricing
View Details