Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDH2 Human Knockdown Lysate
LY300240 100 µg

MDH2 Human Knockdown Lysate

Sign In for Pricing
View Details
Mouse Adenosine Deaminase (ADA) ELISA Kit
NSL1589m 96 Tests

Mouse Adenosine Deaminase (ADA) ELISA Kit

Sign In for Pricing
View Details
VERO Uninfected Cell Extract
MBS568655-01 1 mL

VERO Uninfected Cell Extract

Sign In for Pricing
View Details
VERO Uninfected Cell Extract
MBS568655-02 5x 1 mL

VERO Uninfected Cell Extract

Sign In for Pricing
View Details
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (APC)
MBS6166196-01 0.1 mL

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (APC)

Sign In for Pricing
View Details
ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (APC)
MBS6166196-02 5x 0.1 mL

ZNF41 (Zinc Finger Protein 41, MGC8941, MRX89) (APC)

Sign In for Pricing
View Details