Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Antibody to GRIA3
MAB-606030233 0.1ml

Mouse Monoclonal Antibody to GRIA3

Sign In for Pricing
View Details
ZDHHC14 Protein Vector (Human) (pPM-C-HA)
PV144412 500 ng

ZDHHC14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Hbb-b2 ORF Vector (Mouse) (pORF)
ORF047002 1.0 µg DNA

Hbb-b2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal KvBeta1 Antibody (OTI4E7) [Alexa Fluor 647]
NBP2-71344AF647 0.1 mL

Mouse Monoclonal KvBeta1 Antibody (OTI4E7) [Alexa Fluor 647]

Sign In for Pricing
View Details
MRGPRA2B siRNA (Mouse)
MBS8232619-01 15 nmol

MRGPRA2B siRNA (Mouse)

Sign In for Pricing
View Details
MRGPRA2B siRNA (Mouse)
MBS8232619-02 30 nmol

MRGPRA2B siRNA (Mouse)

Sign In for Pricing
View Details