Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2B Fc, Mouse (HEK293)

IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html

Purity

98.0

Smiles

EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Molecular Formula

16016 (Gene_ID) P01867-2 (E97-K335) (Accession)

Molecular Weight

31-37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Defb42 shRNA (UAS) - Lentiviral mouse Defb42 shRNA (UAS, GFP) plasmid
GTR15217582 1 Vial

Lentiviral mouse Defb42 shRNA (UAS) - Lentiviral mouse Defb42 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Arfrp1 (NM_001165995) Mouse Tagged Lenti ORF Clone
MR221625L4 10 µg

Arfrp1 (NM_001165995) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Zfp703 (NM_001101502) AAV Particle
MR213459A1V 250 µL

Mouse Zfp703 (NM_001101502) AAV Particle

Sign In for Pricing
View Details
Anti-Cytokeratin 6 Rabbit pAb
GB11800-50 50 μL

Anti-Cytokeratin 6 Rabbit pAb

Sign In for Pricing
View Details
GFPT2 Antibody
MBS9630655-01 0.1 mL

GFPT2 Antibody

Sign In for Pricing
View Details
GFPT2 Antibody
MBS9630655-02 0.2 mL

GFPT2 Antibody

Sign In for Pricing
View Details