IgG2B Fc, Mouse (HEK293)
IgG2B Fc Protein is a member of many immunoglobulin G developed and secreted by effective B cells[1]. IgG2B Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2B Fc protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG2B Fc Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg2b-fc-protein-mouse-hek-293.html
Purity
98.0
Smiles
EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Molecular Formula
16016 (Gene_ID) P01867-2 (E97-K335) (Accession)
Molecular Weight
31-37 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
50167121 3x 1.0µg DNA
VPS11 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details MBS6345243-01 0.2 mL
SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6345243-02 5x 0.2 mL
SCARF2, CT (SCARF2, SREC2, SREPCR, Scavenger receptor class F member 2, SRECRP-1, Scavenger receptor expressed by endothelial cells 2 protein) (Azide free) (HRP)
Sign In for Pricing
View Details