Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylococcus aureus Extracellular enterotoxin type I Protein

This Staphylococcus aureus Extracellular enterotoxin type I Protein spans the amino acid sequence from region 1-242aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A0H3JSY8

Expression Region

1-242aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKFKYSFILVFILLFNIKDLTYAQGDIGVGNLRNFYTKHDYIDLKGVTDKNLPIANQLEFSTGTNDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKIATNKKLVTAQEIDVKLRRYLQEEYNIYGHNNTGKGKEYGYKSKFYSGFNNGKVLFHLNNEKSFSYDLFYTGDGLPVSFLKIYEDNKIIESEKFHLDVEISYVDSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal LRTM1 Antibody (2381D) [HRP]
FAB10046H 0.1 mL

Rabbit Monoclonal LRTM1 Antibody (2381D) [HRP]

Sign In for Pricing
View Details
FANCA ORF Vector (Human) (pORF)
20229012 1.0 µg DNA

FANCA ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rsd Antibody
orb828278 2 mg

Rsd Antibody

Sign In for Pricing
View Details
ZNF215 Antibody
OACA03964-50UG 50 µg

ZNF215 Antibody

Sign In for Pricing
View Details
IMAC2 (hydrochloride)
HY-110073-01 1 mg

IMAC2 (hydrochloride)

Sign In for Pricing
View Details
IMAC2 (hydrochloride)
HY-110073-02 5 mg

IMAC2 (hydrochloride)

Sign In for Pricing
View Details