Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FNDC3B Protein

This Human FNDC3B Protein spans the amino acid sequence from region 278-570aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Factor for adipocyte differentiation 104) (HCV NS5A-binding protein 37)

UniProt

Q53EP0

Expression Region

278-570aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG4 Antibody
orb1325801 100 µg

IgG4 Antibody

Sign In for Pricing
View Details
TDE2L Lentiviral Activation Particles (h2)
sc-418484-LAC-2 200 µL

TDE2L Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
E2f7 siRNA Oligos set (Rat)
18837176 3x 5 nmol

E2f7 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Urapidil HCl
MBS575803 Inquire

Urapidil HCl

Sign In for Pricing
View Details
P95/NBS1 (phospho-Ser343) rabbit pAb
ES14286-01 50 µL

P95/NBS1 (phospho-Ser343) rabbit pAb

Sign In for Pricing
View Details
P95/NBS1 (phospho-Ser343) rabbit pAb
ES14286-02 100 µL

P95/NBS1 (phospho-Ser343) rabbit pAb

Sign In for Pricing
View Details