Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Nkg7 Protein

This Mouse Nkg7 Protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Natural killer cell protein 7)

UniProt

Q99PA5

Expression Region

1-165aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPTSQETQVAGYIHVTQSFCILAVLWGLVSVSFLILSCIPALSAPGRGPLVSTVMAFSAALSILVAMAVYTSMRWSQTPFSQVQTFFSWSFYLGWVSFILFLFAGCLSLGAHCRTRRAEYETL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KBTBD8 Protein Vector (Rat) (pPM-C-HA)
PV275572 500 ng

KBTBD8 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit
E-CL-H0258-01 24 Tests

Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit

Sign In for Pricing
View Details
Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit
E-CL-H0258-02 48 Tests

Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit

Sign In for Pricing
View Details
Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit
E-CL-H0258-03 96 Tests

Human AMY1 (Amylase Alpha 1, Salivary) CLIA Kit

Sign In for Pricing
View Details
Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated
orb3008312-01 20 µg

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated
orb3008312-02 100 µg

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated

Sign In for Pricing
View Details