Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR560815 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
BLNK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]
TA808522AM 100 µL

BLNK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
CHAC1 (NM_024111) Human Over-expression Lysate
LC432159 20 µg

CHAC1 (NM_024111) Human Over-expression Lysate

Sign In for Pricing
View Details
3,3,3-Trideuterio-2,2-difluoro-propanoic Acid
TRC-D223100-10MG 10 mg

3,3,3-Trideuterio-2,2-difluoro-propanoic Acid

Sign In for Pricing
View Details
WFS1 (NM_001145853) Human Over-expression Lysate
LY429034 100 µg

WFS1 (NM_001145853) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit
RD-PDGFRa-Hu-01 96 Tests

Human Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit

Sign In for Pricing
View Details