Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 3-35 (HV335), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 3-35 IGHV3-35

UniProt

A0A0C4DH35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSNSDMNWVHQAPGKGLEWVSGVSWNGSRTHYADSVKGRFIISRDNSRNTLYLQTNSLRAEDTAVYYCVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Thyroid gland
CS708711 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW06F-PA/W 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
DNA helicase HEL308 (HELQ) Human qPCR Primer Pair (NM_133636)
HP216882 200 Reactions

DNA helicase HEL308 (HELQ) Human qPCR Primer Pair (NM_133636)

Sign In for Pricing
View Details
RAD51 Antibody
KC-1987-01 50 μL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1987-02 100 µL

RAD51 Antibody

Sign In for Pricing
View Details
RAD51 Antibody
KC-1987-03 1 mL

RAD51 Antibody

Sign In for Pricing
View Details