Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neuron navigator 3 (Nav3), partial

This Recombinant Mouse Neuron navigator 3 (Nav3), partial spans the amino acid sequence from region 77-184aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuron navigator 3 (Pore membrane and/or filament-interacting-like protein 1)

UniProt

Q80TN7

Expression Region

77-184aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitofusin 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0557R-BF555 100 µL

Mitofusin 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Human CTHRC1 protein
orb705153-01 20 µg

Human CTHRC1 protein

Sign In for Pricing
View Details
Human CTHRC1 protein
orb705153-02 100 µg

Human CTHRC1 protein

Sign In for Pricing
View Details
Human CTHRC1 protein
orb705153-03 1 mg

Human CTHRC1 protein

Sign In for Pricing
View Details
Bacterial Sialidase Antibody
GWB-9CC345 1 mL

Bacterial Sialidase Antibody

Sign In for Pricing
View Details
CD40 Mouse Monoclonal Antibody [Clone ID: OTI8C5]
TA807573S 30 µL

CD40 Mouse Monoclonal Antibody [Clone ID: OTI8C5]

Sign In for Pricing
View Details