Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTHRC1 protein

This Human CTHRC1 protein spans the amino acid sequence from region 31-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96CG8

Expression Region

31-243aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amy2a4 Recombinant Protein (Mouse)
RP115664 100 µg

Amy2a4 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-NT5E / CD73 Reference Antibody (mupadolimab)
E24CHA903 100 µg

Anti-NT5E / CD73 Reference Antibody (mupadolimab)

Sign In for Pricing
View Details
Cpn10 (HSPE1) (NM_002157) Human Untagged Clone
SC118785 10 µg

Cpn10 (HSPE1) (NM_002157) Human Untagged Clone

Sign In for Pricing
View Details
SYN2 siRNA Oligos set (Human)
45960171 3x 5 nmol

SYN2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Nat8f7 shRNA (UAS) - Lentiviral mouse Nat8f7 shRNA (UAS, GFP) (100)
GTR15269913 1 Vial

Lentiviral mouse Nat8f7 shRNA (UAS) - Lentiviral mouse Nat8f7 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Thp (Tamm–Horsfall Glycoprotein) ELISA Kit
FY-EH2338 96 Well

Human Thp (Tamm–Horsfall Glycoprotein) ELISA Kit

Sign In for Pricing
View Details