Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTHRC1 protein

This Human CTHRC1 protein spans the amino acid sequence from region 31-243aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q96CG8

Expression Region

31-243aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quercetin dihydrate 200mg
A10765-200 200 mg

Quercetin dihydrate 200mg

Sign In for Pricing
View Details
ATG5 HDR Plasmid (m)
sc-419149-HDR 20 µg

ATG5 HDR Plasmid (m)

Sign In for Pricing
View Details
Rnase2b Mouse shRNA Plasmid (Locus ID 54159)
TL513971 1 Kit

Rnase2b Mouse shRNA Plasmid (Locus ID 54159)

Sign In for Pricing
View Details
CDX2 Antibody Blocking peptide
orb1448343 500 µg

CDX2 Antibody Blocking peptide

Sign In for Pricing
View Details
Monoclonal Antibody to Guanylate Cyclase Activator 2A (GUCA2A)
TRV-0060008-01 20 µL

Monoclonal Antibody to Guanylate Cyclase Activator 2A (GUCA2A)

Sign In for Pricing
View Details
Monoclonal Antibody to Guanylate Cyclase Activator 2A (GUCA2A)
TRV-0060008-02 100 µL

Monoclonal Antibody to Guanylate Cyclase Activator 2A (GUCA2A)

Sign In for Pricing
View Details