Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF10C protein

This Human TNFRSF10C protein spans the amino acid sequence from region 26-221aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID

UniProt

O14798

Expression Region

26-221aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 0.56 ng/ml.

Form

Lyophilized powder

Molecular Weight

21.78 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttll12 (NM_183017) Mouse Tagged ORF Clone Lentiviral Particle
MR209682L3V 200 µL

Ttll12 (NM_183017) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cytochrome P450 4V2 Antibody
E51A04669 100 µL

Cytochrome P450 4V2 Antibody

Sign In for Pricing
View Details
BOLL (Protein Boule-like, BOULE) (AP)
MBS6371387-01 0.1 mL

BOLL (Protein Boule-like, BOULE) (AP)

Sign In for Pricing
View Details
BOLL (Protein Boule-like, BOULE) (AP)
MBS6371387-02 5x 0.1 mL

BOLL (Protein Boule-like, BOULE) (AP)

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial
RPC28236-01 20 µg

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial
RPC28236-02 100 µg

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Sign In for Pricing
View Details