Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) . Target Name: L. Target Synonyms: Large structural proteinReplicaseTranscriptase. Accession Number: Q05318. Expression Region: 625~809aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein.

Accession Number

Q05318

Expression Region

625~809aa

Host

E. coli

Target

L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Large structural proteinReplicaseTranscriptase

Species

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Protein Name

Recombinant Protein

AA Sequence

RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serinc4 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3291104 1.0 µg DNA

Serinc4 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GPR15, NT, Blocking Peptide (G-Protein-coupled Receptor 15, Brother of Bonzo)
G8585P 50 µg

GPR15, NT, Blocking Peptide (G-Protein-coupled Receptor 15, Brother of Bonzo)

Sign In for Pricing
View Details
Olfr1287 Protein Vector (Mouse) (pPB-C-His)
PV208842 500 ng

Olfr1287 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
EPPIN (EPPIN-WFDC6) (NM_001198986) Human Tagged Lenti ORF Clone
RC231024L3 10 µg

EPPIN (EPPIN-WFDC6) (NM_001198986) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hyal5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV638329 1.0 µg DNA

Hyal5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RIC8B Protein Vector (Mouse) (pPM-C-HA)
39576025 500 ng

RIC8B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details