Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) . Target Name: L. Target Synonyms: Large structural proteinReplicaseTranscriptase. Accession Number: Q05318. Expression Region: 625~809aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein.

Accession Number

Q05318

Expression Region

625~809aa

Host

E. coli

Target

L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Large structural proteinReplicaseTranscriptase

Species

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Protein Name

Recombinant Protein

AA Sequence

RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Deinococcus radiodurans Membrane protein insertase YidC (yidC), partial
MBS7101025 Inquire

Recombinant Deinococcus radiodurans Membrane protein insertase YidC (yidC), partial

Sign In for Pricing
View Details
VEGF-R2 (CD309, Fetal liver kinase 1 (FLK-1), KDR, Kinase insert domain receptor (a type III receptor tyrosine kinase), KRD1, Ly73, Protein tyrosine kinase receptor FLK1, Protein-tyrosine kinase receptor flk-1, Vascular endothelial growth factor receptor 2) (BSA & Azide Free) (MaxLight 650)
168889-AF-ML650 100 µL

VEGF-R2 (CD309, Fetal liver kinase 1 (FLK-1), KDR, Kinase insert domain receptor (a type III receptor tyrosine kinase), KRD1, Ly73, Protein tyrosine kinase receptor FLK1, Protein-tyrosine kinase receptor flk-1, Vascular endothelial growth factor receptor 2) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
LARP7, CT (LARP7, La-related protein 7, La ribonucleoprotein domain family member 7, P-TEFb-interaction protein for 7SK stability) (MaxLight 550)
MBS6315224-01 0.1 mL

LARP7, CT (LARP7, La-related protein 7, La ribonucleoprotein domain family member 7, P-TEFb-interaction protein for 7SK stability) (MaxLight 550)

Sign In for Pricing
View Details
LARP7, CT (LARP7, La-related protein 7, La ribonucleoprotein domain family member 7, P-TEFb-interaction protein for 7SK stability) (MaxLight 550)
MBS6315224-02 5x 0.1 mL

LARP7, CT (LARP7, La-related protein 7, La ribonucleoprotein domain family member 7, P-TEFb-interaction protein for 7SK stability) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Anti-Duck IgY H&L Antibody (AF555)
abx142426-01 100 µL

Rabbit Anti-Duck IgY H&L Antibody (AF555)

Sign In for Pricing
View Details
Rabbit Anti-Duck IgY H&L Antibody (AF555)
abx142426-02 500 µL

Rabbit Anti-Duck IgY H&L Antibody (AF555)

Sign In for Pricing
View Details