Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) . Target Name: L. Target Synonyms: Large structural proteinReplicaseTranscriptase. Accession Number: Q05318. Expression Region: 625~809aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein.

Accession Number

Q05318

Expression Region

625~809aa

Host

E. coli

Target

L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Large structural proteinReplicaseTranscriptase

Species

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Protein Name

Recombinant Protein

AA Sequence

RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Tissue factor pathway inhibitor, TFPI ELISA Kit
QY-E30091 96 Tests

Rabbit Tissue factor pathway inhibitor, TFPI ELISA Kit

Sign In for Pricing
View Details
FAR2 ORF Vector (Human) (pORF)
ORF003925 1.0 µg DNA

FAR2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
14-3-3 alpha/beta Recombinant Rabbit mAb
BS45611-01 50 µL

14-3-3 alpha/beta Recombinant Rabbit mAb

Sign In for Pricing
View Details
14-3-3 alpha/beta Recombinant Rabbit mAb
BS45611-02 100 µL

14-3-3 alpha/beta Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rat Monoclonal CD4 Antibody (GK1.5) [mFluor Violet 450 SE]
FAB554MFV450 0.1 mL

Rat Monoclonal CD4 Antibody (GK1.5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
DNAJB5 Antibody (YA8171, Mouse)
HY-P88487 1 Each

DNAJB5 Antibody (YA8171, Mouse)

Sign In for Pricing
View Details