Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) . Target Name: L. Target Synonyms: Large structural proteinReplicaseTranscriptase. Accession Number: Q05318. Expression Region: 625~809aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein.

Accession Number

Q05318

Expression Region

625~809aa

Host

E. coli

Target

L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Large structural proteinReplicaseTranscriptase

Species

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Protein Name

Recombinant Protein

AA Sequence

RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human L1CAM knockout cell line
ABC-KH8252 1 Vial

Human L1CAM knockout cell line

Sign In for Pricing
View Details
Sox2 (Thr-118), phospho-specific Antibody
MBS474608-01 0.1 mL

Sox2 (Thr-118), phospho-specific Antibody

Sign In for Pricing
View Details
Sox2 (Thr-118), phospho-specific Antibody
MBS474608-02 5x 0.1 mL

Sox2 (Thr-118), phospho-specific Antibody

Sign In for Pricing
View Details
Mouse Monoclonal 14-3-3 beta Antibody (05) [DyLight 680]
NBP3-06157FR 0.1 mL

Mouse Monoclonal 14-3-3 beta Antibody (05) [DyLight 680]

Sign In for Pricing
View Details
GENLISA™ Human Aldolase (ALD) ELISA
KBH0837 1x 96 Well

GENLISA™ Human Aldolase (ALD) ELISA

Sign In for Pricing
View Details
Human LRFN2 Knockout HEK293T cell line
GTR15418886 1 Vial

Human LRFN2 Knockout HEK293T cell line

Sign In for Pricing
View Details