Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G12A protein

This Human PLA2G12A protein spans the amino acid sequence from region 23-189aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase 12A (GXII sPLA2) (sPLA2-XII) (PLA2G12)

UniProt

Q9BZM1

Expression Region

23-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2, phosphorylated (Ser185) (Murine Double Minute-2)
MBS626571-01 0.1 mg

MDM2, phosphorylated (Ser185) (Murine Double Minute-2)

Sign In for Pricing
View Details
MDM2, phosphorylated (Ser185) (Murine Double Minute-2)
MBS626571-02 5x 0.1 mg

MDM2, phosphorylated (Ser185) (Murine Double Minute-2)

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF405S conjugate, 0.1mg/mL
BNC043789-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Copg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3750607 1.0 µg DNA

Copg2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TREH siRNA (Mouse)
orb1843142-01 15 nmol

TREH siRNA (Mouse)

Sign In for Pricing
View Details
TREH siRNA (Mouse)
orb1843142-02 30 nmol

TREH siRNA (Mouse)

Sign In for Pricing
View Details