Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTGES3 protein

This Human PTGES3 protein spans the amino acid sequence from region 1-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic prostaglandin E2 synthase (cPGES) (Hsp90 co-chaperone) (Progesterone receptor complex p23) (Telomerase-binding protein p23)

UniProt

Q15185

Expression Region

1-160aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Snx3 shRNA (UAS) - Lentiviral mouse Snx3 shRNA (UAS) (25)
GTR15234917 1 Vial

Lentiviral mouse Snx3 shRNA (UAS) - Lentiviral mouse Snx3 shRNA (UAS) (25)

Sign In for Pricing
View Details
HPIV2 Human IgM
C010604 1 mg

HPIV2 Human IgM

Sign In for Pricing
View Details
RAB14 Polyclonal Antibody
RA34322-01 50 µL

RAB14 Polyclonal Antibody

Sign In for Pricing
View Details
RAB14 Polyclonal Antibody
RA34322-02 100 µL

RAB14 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Uncharacterized protein F54C8.6 (F54C8.6)
orb2926485-01 20 µg

Recombinant Uncharacterized protein F54C8.6 (F54C8.6)

Sign In for Pricing
View Details
Recombinant Uncharacterized protein F54C8.6 (F54C8.6)
orb2926485-02 100 µg

Recombinant Uncharacterized protein F54C8.6 (F54C8.6)

Sign In for Pricing
View Details