Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F54C8.6 (F54C8.6)

This Recombinant Uncharacterized protein F54C8.6 (F54C8.6) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Uncharacterized protein F54C8.6

UniProt

P34444

Expression Region

1-325

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGRYEVQNRYSAYIEARRNYLEQSESEEDIEVRTILRRPQIYSRRTVSTSSEEQPTTPA MVLVPTVTIQEAPKVVEIPTNGLPEPTPSSSVVQEIEILAPNEDEVKEEKPSDCTTCKKI ENFVMPYYESLKAKYQQFVVRISDPALHATIRSEFAEYFPSVLLGFAIFFFGITFISFIK LLRGVSTQPSFFCRYFSGPFSPLFDALCEPDPYVLSEELPKVMSGLLDEMFITISEFFQT ISKGFTVFGTLFTAIWHGLSENVFFGFHELGENLGENINHLLHFVVQFFHQIIHLILSSI ATIAGAIAGVFTSVHDYLEPPQNVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL32 Rabbit Polyclonal Antibody
AP20770PU-N 100 µg

IL32 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559110 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Single Beam Visible Spectrophotometer BSSBV-203-A
BSSBV-203-A Each

Single Beam Visible Spectrophotometer BSSBV-203-A

Sign In for Pricing
View Details
MIR583 Human qPCR Primer Pair (MI0003590)
HP300495 200 Reactions

MIR583 Human qPCR Primer Pair (MI0003590)

Sign In for Pricing
View Details
(R)-(-)-1-[(S)-2-Diphenylphosphino)ferrocenyl]ethyldi-t-butylphosphine
TRC-D491715-500MG 500 mg

(R)-(-)-1-[(S)-2-Diphenylphosphino)ferrocenyl]ethyldi-t-butylphosphine

Sign In for Pricing
View Details
PCTAIRE1 (CDK16) (NM_006201) Human Recombinant Protein
TP324555L 1 mg

PCTAIRE1 (CDK16) (NM_006201) Human Recombinant Protein

Sign In for Pricing
View Details