Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein F54C8.6 (F54C8.6)

This Recombinant Uncharacterized protein F54C8.6 (F54C8.6) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Uncharacterized protein F54C8.6

UniProt

P34444

Expression Region

1-325

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGRYEVQNRYSAYIEARRNYLEQSESEEDIEVRTILRRPQIYSRRTVSTSSEEQPTTPA MVLVPTVTIQEAPKVVEIPTNGLPEPTPSSSVVQEIEILAPNEDEVKEEKPSDCTTCKKI ENFVMPYYESLKAKYQQFVVRISDPALHATIRSEFAEYFPSVLLGFAIFFFGITFISFIK LLRGVSTQPSFFCRYFSGPFSPLFDALCEPDPYVLSEELPKVMSGLLDEMFITISEFFQT ISKGFTVFGTLFTAIWHGLSENVFFGFHELGENLGENINHLLHFVVQFFHQIIHLILSSI ATIAGAIAGVFTSVHDYLEPPQNVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS808980 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
DOG-1 (DG1/447 + DOG1.1), CF740 conjugate, 0.1mg/mL
BNC740726-500 1x 500 µL

DOG-1 (DG1/447 + DOG1.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TMEM194A (NEMP1) activation kit by CRISPRa
GA108205 1 Kit

Human TMEM194A (NEMP1) activation kit by CRISPRa

Sign In for Pricing
View Details
4-(Phenylamino]-1-benzyl-4-piperidinecarboxylic Acid-d4
TRC-P307493-50MG 50 mg

4-(Phenylamino]-1-benzyl-4-piperidinecarboxylic Acid-d4

Sign In for Pricing
View Details
Brd4 Rabbit Polyclonal Antibody
ER1901-02 100 µL

Brd4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SYT10 Human qPCR Primer Pair (NM_198992)
HP219458 200 Reactions

SYT10 Human qPCR Primer Pair (NM_198992)

Sign In for Pricing
View Details