Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Vitamin D-binding protein protein

This Human Vitamin D-binding protein protein spans the amino acid sequence from region 19-474aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gc protein-derived macrophage activating factor

UniProt

P02774

Expression Region

19-474aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 19-474aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH2 3'UTR Luciferase Stable Cell Line
TU010424 1.0 mL

IDH2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)
orb1494732-01 1 mg

RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)

Sign In for Pricing
View Details
RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)
orb1494732-02 5 µg

RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)

Sign In for Pricing
View Details
RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)
orb1494732-03 25 µg

RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Ribonuclease HII (rnhB)
MBS1016693-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Ribonuclease HII (rnhB)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Ribonuclease HII (rnhB)
MBS1016693-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Ribonuclease HII (rnhB)

Sign In for Pricing
View Details